Recombinant Mouse IL-17 (His, Flag)
Catalog No.
PM1018
Recombinant Mouse IL-17
Featured Products
The interleukin-17 (IL-17) protein, originally described, now known as IL-17A, is a homodimer consisting of two chains containing 132 amino acids each, secreted by activated T cells. It acts on stromal cells to induce the production of pro-inflammatory and hematopoietic bioactive molecules. Mouse IL-17 has 63% amino acid identity with human IL-17, and IL-17A has cross-species biological activity between human and mouse cells.
| Gene ID | 16196 |
| Accession # | Q544C8 |
| Alternate Names | Cytotoxic T-lymphocyte-associated antigen 8; CLTA-8 ; IL-17A |
| Source | HEK293 |
| Protein sequence | ECHIKDKEGKAYESVLMISIDELDKMTGTDSNCPNNEPNFFRKHVCDDTKEAAFLNRAARKLKQFLKMNISEEFNVHLLTVSQGTQTLVNCTSKEEKNVKEQKKNDACFLKRLLREIKTCWNKILKGSI |
| M.Wt | The protein has a calculated MW of 14.8 KDa |
| Appearance | Solution protein. |
| Stability & Storage | Avoid repeated freeze-thaw cycles. It is recommended that the protein be aliquoted for optimal storage. 3 years from date of receipt, -20 to -70 °C as supplied. |
| Concentration | 1 mg/mL |
| Formulation | Supplied as a 0.2 μm filtered solution in PBS, pH7.4. |
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. This solution can be diluted into other aqueous buffers. |
| Biological Activity | Fully biologically active as determined by a cell proliferation assay using PHA-activated human peripheral blood lymphocytes (PBL). The EC50 for this effect is 0.6 ng/mL. |
| Shipping Condition | Shipping with dry ice. |
| Usage | For Research Use Only! Not to be used in humans. |
Quality Control & DataSheet
- View current batch:
-
Purity > 95 % by SDS-PAGE
- Datasheet
Endotoxin: Less than 1.0 EU/μg as determined by LAL method.