VIP (human, rat, mouse, rabbit, canine, porcine)
Aviptadil (CAS: 40077-57-4), also known as vasoactive intestinal peptide (VIP), is a bioactive neuropeptide composed of 28 amino acids with the sequence HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH₂. Human VIP is derived from a 170-amino-acid precursor protein, prepro-VIP, through post-translational processing.The mature VIP sequence is completely conserved (100% sequence identity) across common mammalian species, including human, monkey, pig, cow, dog, rabbit, rat, and mouse.
The mature VIP peptide exerts potent pulmonary vasodilatory effects, relaxes bronchial smooth muscle, reduces the release of pro-inflammatory mediators, modulates immune responses, and participates in neuroendocrine signaling. It has been widely studied in pulmonary fibrosis, pulmonary arterial hypertension, and SARS-CoV-2–associated respiratory failure.
Reference:
1. Delgado M, Ganea D. Vasoactive intestinal peptide: a neuropeptide with pleiotropic immune functions. Amino Acids. 2013 Jul;45(1):25-39. doi: 10.1007/s00726-011-1184-8. Epub 2011 Dec 3. PMID: 22139413; PMCID: PMC3883350.
2. Gutzler C, Höhne K, Bani D, Kayser G, Fähndrich S, Ambros M, Hug MJ, Rieg S, Falcone V, Müller-Quernheim J, Zissel G, Frye BC. Vasoactive Intestinal Peptide (VIP) in COVID-19 Therapy-Shedding of ACE2 and TMPRSS2 via ADAM10. Int J Mol Sci. 2025 Mar 16;26(6):2666. doi: 10.3390/ijms26062666. PMID: 40141308; PMCID: PMC11942504.
| Physical Appearance | White lyophilised solid |
| Storage | Store at -20°C |
| M.Wt | 3325.83 |
| Cas No. | 40077-57-4 |
| Formula | C147H238N44O42S |
| Solubility | insoluble in EtOH; ≥21.8 mg/mL in DMSO; ≥46.3 mg/mL in H2O |
| Shipping Condition | Small Molecules with Blue Ice, Modified Nucleotides with Dry Ice. |
| General tips | We do not recommend long-term storage for the solution, please use it up soon. |
Quality Control & MSDS
- View current batch:
Chemical structure
