Setting 
My Cart
Toggle Nav
Close
  • Menu
  • Setting

Super-TDU TFA

Catalog No.
C8695
A YAP inhibitor
Grouped product items
SizePriceStock Qty
1mg
$120.00
Ship with 5-10 days
5mg
$350.00
Ship with 5-10 days
10mg
$550.00
Ship with 5-10 days
For scientific research use only and should not be used for diagnostic or medical purposes.

Tel: +1-832-696-8203

Email: [email protected]

Worldwide Distributors

Background

Super-TDU TFA is the trifluoroacetate salt form of Super-TDU (CAS No.: 1599441-71-0; Catalog No.: BA9130). As a specific inhibitor of the Hippo signaling pathway, Super-TDU targets Yes-associated protein (YAP) as its core molecular target, with a commonly used experimental concentration ranging from 2 to 5 μM. Its biological activities are primarily characterized by the regulation of tumor cell stemness and reversal of chemoresistance: in hepatocellular carcinoma (HCC), it can reverse MCM2-mediated activation of the Hippo signaling pathway, impair the sphere-forming and self-renewal capacities of HCC cells, and enhance the sensitivity of sorafenib-resistant cells to sorafenib (CAS No.: 284461-73-0; Catalog No.: A3009); in glioma, it inhibits neuropilin-1 (NRP1) overexpression-induced YAP nuclear translocation and upregulation of stemness markers (CD133 and CD44), reverses glioma cell resistance to temozolomide (TMZ; CAS No.: 85622-93-1; Catalog No.: B1399), and concurrently suppresses the sphere-forming and colony-forming abilities of tumor cells.

References:

[1] Zhou X, Luo J, Xie H, Wei Z, Li T, Liu J, Liao X, Zhu G, Peng T. MCM2 promotes the stemness and sorafenib resistance of hepatocellular carcinoma cells via hippo signaling. Cell Death Discov. 2022 Oct 15;8(1):418. doi: 10.1038/s41420-022-01201-3. PMID: 36243809; PMCID: PMC9569387.

[2] Jin L, Jin A, Wang L, Qi X, Jin Y, Zhang C, Niu M. NRP1 Induces Enhanced Stemness and Chemoresistance in Glioma Cells via YAP. Biol Pharm Bull. 2024;47(1):166-174. doi: 10.1248/bpb.b23-00630. PMID: 38220212.

Chemical Properties

Storage-80°C, sealed storage, away from moisture and light
M.Wt5280.92 (free acid)
Cas No.1599441-71-0(free base)
FormulaC237H369N65O70S.xC2HF3O2
Solubility≥18.89 mg/mL in DMSO with ultrasonic; ≥6.31 mg/mL in EtOH with ultrasonic; ≥58 mg/mL in H2O
Shipping ConditionSmall Molecules with Blue Ice, Modified Nucleotides with Dry Ice.
General tips We do not recommend long-term storage for the solution, please use it up soon.

Sequence

SVDDHFAKSLGDTWLQIGGSGNPKTANVPQTVPMRLRKLPDSFFKPPE

Quality Control

Quality Control & MSDS

View current batch:

Chemical structure

Super-TDU TFA