Recombinant Swine GM-CSF (His, Flag)
Granulocyte-macrophage colony-stimulating factor (GM-CSF) is secreted by several different types of cells, including activated T cells, B cells, macrophages, mast cells, endothelial cells, and fibroblasts, in response to cytokines or immune and inflammatory stimuli. It was originally described as a growth factor that can support in vitro colony formation of granulocyte-macrophage progenitor cells and has the function of stimulating the growth and differentiation of hematopoietic precursor cells from different lineages. GM-CSF has also been reported to have functional effects on non-hematopoietic cells and can induce human endothelial cell migration and proliferation. In addition, it stimulates the proliferation of a variety of tumor cell lines, including osteoblastic sarcoma, carcinoma, and adenocarcinoma cell lines. GM-CSF is used as a drug to stimulate the production of white blood cells after chemotherapy and has recently been evaluated in clinical trials as a vaccine adjuvant in HIV-infected patients.
| Gene ID | U61139.1 |
| Accession # | Q29118 |
| Alternate Names | Porcine GM-CSF; Porcine CSF2; Porcine Granulocyte-Macrophage Colony-Stimulating Factor |
| Source | HEK293 |
| Protein sequence | APTRPPSPVTRPWQHVDAIKEALSLLNNSNDTAAVMNETVDVVCEMFDPQEPTCVQTRLNLYKQGLRGSLTRLKSPLTLLAKHYEQHCPLTEETSCETQSITFKSFKDSLNKFLFTIPFDCWGPVKK |
| M.Wt | The protein has a calculated MW of 14.3 KDa |
| Appearance | Solution protein. |
| Stability & Storage | Avoid repeated freeze-thaw cycles. It is recommended that the protein be aliquoted for optimal storage. 3 years from date of receipt, -20 to -70 °C as supplied. |
| Concentration | 1 mg/mL |
| Formulation | Supplied as a 0.2 μm filtered solution in PBS, pH7.4. |
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. This solution can be diluted into other aqueous buffers. |
| Biological Activity | Fully biologically active as determined by a cell proliferation assay using TF-1 human erythroleukemic cells. The EC50 for this effect is 3-15 ng/mL. |
| Shipping Condition | Shipping with dry ice. |
| Usage | For Research Use Only! Not to be used in humans. |
Quality Control & DataSheet
- View current batch:
-
Purity > 95 % by SDS-PAGE
- Datasheet
Endotoxin: Less than 1.0 EU/μg as determined by LAL method.