Recombinant Mouse SCF (His, Flag)
Stem Cell Factor (SCF) which binds to the c-Kit receptor is produced by fibroblasts and endothelial cells. The soluble and transmembrane forms of the protein are formed by alternative splicing of the same RNA transcript and the presence of both soluble and transmembrane It is required for normal hematopoietic function and plays an important role in hematopoiesis, spermatogenesis, and melanogenesis. It also promotes mast cell adhesion, migration, proliferation, and survival.
Reference:
1. Ronnstrand L. 2004. Cell Mol Life Sci. 61:2535-48
2. Anderson DM, Williams DE, Tushinski R, et al. 1991. Cell Growth Differ. 2:373-8
3. Brannan CI, Lyman SD, Williams DE, et al. 1991. Proc Natl Acad Sci U S A. 88:4671-4
4. Okayama Y, Kawakami T. 2006. Immunol Res. 34:97-115.
| Gene ID | 17311 |
| Accession # | P20826 |
| Alternate Names | Hematopoietic?growth?factor?KL;?MGF;?SCF; Kit ligand; Hematopoietic growth factor KL; c-Kit ligand |
| Source | HEK293 |
| Protein sequence | KEICGNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVIQLSLSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVLCMEENAPKNIKESPKRPETRSFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVA |
| M.Wt | The protein has a calculated MW of 20.3 KDa. |
| Appearance | Solution protein |
| Stability & Storage | Use a manual defrost freezer and avoid repeated freeze-thaw cycles - 36 months from date of receipt, -20 to -70°C as supplied |
| Concentration | 1 mg/mL |
| Formulation | Supplied as a 0.2 μm filtered solution in PBS, pH7.4. |
| Biological Activity | Fully biologically active as determined by a cell proliferation assay using MC/9 mouse mast cells. The EC50 for this effect is 10 ng/mL. |
| Shipping Condition | Shipping with dry ice. |
| Usage | For Research Use Only! Not to be used in humans. |
