Recombinant Mouse IL-7 (His, Flag)
Interleukin-7 (IL-7) is a potent lymphoid cell growth factor produced by bone marrow and thymic stromal cells, spleen cells and keratinocytes. IL7 stimulates the proliferation of Pre-B, Pro-B and early T cells. IL-7 can co-stimulate the proliferation of mature T cells in combination with other factors such as ConA and IL-2. Also, IL-7 stimulates the maturation of megakaryocytes and the proliferation and differentiation of NK cells.
The murine IL-7 cDNA encodes a 154 aa protein with a 25 aa signal sequence. Human and murine IL-7 is cross-species reactive. Recombinant murine IL-7 is a 15.0 kDa protein containing 130 amino acid residues.
| Gene ID | 16196 |
| Accession # | P10168 |
| Alternate Names | IL7;?IL-7;?Interleukin-7 |
| Source | HEK293 |
| Protein sequence | ECHIKDKEGKAYESVLMISIDELDKMTGTDSNCPNNEPNFFRKHVCDDTKEAAFLNRAARKLKQFLKMNISEEFNVHLLTVSQGTQTLVNCTSKEEKNVKEQKKNDACFLKRLLREIKTCWNKILKGSI |
| M.Wt | The protein has a calculated MW of 28.2 KDa. |
| Appearance | Solution protein |
| Stability & Storage | Use a manual defrost freezer and avoid repeated freeze-thaw cycles - 36 months from date of receipt, -20 to -70°C as supplied |
| Concentration | 1 mg/mL |
| Formulation | Supplied as a 0.2 μm filtered solution in PBS, pH7.4. |
| Biological Activity | Fully biologically active as determined by a cell proliferation assay using PHA-activated human peripheral blood lymphocytes (PBL). The EC50 for this effect is 0.6 ng/mL. |
| Shipping Condition | Shipping with dry ice. |
| Usage | For Research Use Only! Not to be used in humans. |






