Setting 
My Cart
Toggle Nav
Close
  • Menu
  • Setting

Recombinant Mouse IL-5, Tag Free

Catalog No.
P3055
Recombinant Mouse IL-5 (E.coli, Tag Free, Liquid)
Grouped product items
Size Price Stock Qty
10ug
$117.00
In stock
100ug
$541.00
In stock
500ug
$1,515.00
In stock
1mg
$2,273.00
In stock
For scientific research use only and should not be used for diagnostic or medical purposes.

Tel: +1-832-696-8203

Email: [email protected]

Worldwide Distributors

Background

IL-5, also named B-cell differentiation factor I, eosinophil differentiation factor and TRF, is belonging to the cytokine family and the IL-5 gene is in close proximity to the genes encoding IL-3, IL-4, and granulocyte-macrophage colony-stimulating factor (GM-CSF), which are often co-expressed in TH2 cells. Through binding to the IL-5 receptor, IL-5 stimulates B cell growth and increases immunroglobulin secretion. It is also a key mediator in eosinophil activation. Interleukin-5 has long been associated with the cause of several allergic diseases including allergic rhinitis and asthma. The cDNA for murine IL-5 encodes a signal peptide and a 113 amino acid mature protein. Mature murine IL-5 shares 70 %, 94 %, 58 %, 66 %, 59 % and 63 % a.a. sequence identity with human, rat, canine, equine, feline and porcine IL5, respectively. It shows cross-reactivity with human IL5 receptor.

Information

Gene ID16191
Accession #P04401
Alternate NamesInterleukin-5, B-cell growth factor II (BCGF-II) , Cytotoxic T-lymphocyte inducer
SourceE.coli
Protein sequenceMEIPMSTVVKETLTQLSAHRALLTSNETMRLPVPTHKNHQLCIGEIFQGLDILKNQTVRGG TVEMLFQNLSLIKKYIDRQKEKCGEERRRTRQFLDYLQEFLGVMSTEWAMEG
M.WtThe protein has a calculated MW of 13.1 KDa.
AppearanceSolution protein
Stability & Storage

Use a manual defrost freezer and avoid repeated freeze-thaw cycles

- 36 months from date of receipt, -20 to -70°C as supplied

Concentration1 mg/mL
FormulationSupplied as a 0.2 μm filtered solution in PBS, pH7.4.
Biological ActivityFully biologically active as determined by a cell proliferation assay using TF?1 human erythroleukemic cells. The EC50 for this effect is 0.01-0.25 ng/mL. Fully biologically active as determined by a cell proliferation assay using BaF3 mouse pro?B cells transfected with mIL-5 R alpha. The EC50 for this effect is 0.3 ng/mL.
Shipping ConditionShipping with dry ice.
UsageFor Research Use Only! Not to be used in humans.

Quality Control

Quality Control & DataSheet

View current batch: