Recombinant Mouse IL-5, Tag Free
IL-5, also named B-cell differentiation factor I, eosinophil differentiation factor and TRF, is belonging to the cytokine family and the IL-5 gene is in close proximity to the genes encoding IL-3, IL-4, and granulocyte-macrophage colony-stimulating factor (GM-CSF), which are often co-expressed in TH2 cells. Through binding to the IL-5 receptor, IL-5 stimulates B cell growth and increases immunroglobulin secretion. It is also a key mediator in eosinophil activation. Interleukin-5 has long been associated with the cause of several allergic diseases including allergic rhinitis and asthma. The cDNA for murine IL-5 encodes a signal peptide and a 113 amino acid mature protein. Mature murine IL-5 shares 70 %, 94 %, 58 %, 66 %, 59 % and 63 % a.a. sequence identity with human, rat, canine, equine, feline and porcine IL5, respectively. It shows cross-reactivity with human IL5 receptor.
| Gene ID | 16191 |
| Accession # | P04401 |
| Alternate Names | Interleukin-5, B-cell growth factor II (BCGF-II) , Cytotoxic T-lymphocyte inducer |
| Source | E.coli |
| Protein sequence | MEIPMSTVVKETLTQLSAHRALLTSNETMRLPVPTHKNHQLCIGEIFQGLDILKNQTVRGG TVEMLFQNLSLIKKYIDRQKEKCGEERRRTRQFLDYLQEFLGVMSTEWAMEG |
| M.Wt | The protein has a calculated MW of 13.1 KDa. |
| Appearance | Solution protein |
| Stability & Storage | Use a manual defrost freezer and avoid repeated freeze-thaw cycles - 36 months from date of receipt, -20 to -70°C as supplied |
| Concentration | 1 mg/mL |
| Formulation | Supplied as a 0.2 μm filtered solution in PBS, pH7.4. |
| Biological Activity | Fully biologically active as determined by a cell proliferation assay using TF?1 human erythroleukemic cells. The EC50 for this effect is 0.01-0.25 ng/mL. Fully biologically active as determined by a cell proliferation assay using BaF3 mouse pro?B cells transfected with mIL-5 R alpha. The EC50 for this effect is 0.3 ng/mL. |
| Shipping Condition | Shipping with dry ice. |
| Usage | For Research Use Only! Not to be used in humans. |