Recombinant Mouse IL-5 (His, Strep)
Interleukin 5 (IL-5) is a secreted glycoprotein that belongs to the α-helix class of cytokines. Unlike other family members, it exists in the form of covalently attached antiparallelismamers. The mouse IL-5 gene encodes a signal peptide and a 113-amino acid (AA) mature protein. Mature mouse IL-5 exhibits amino acid sequence homology of 70%, 94%, 58%, 66%, 59%, and 63% to human, rat, canine, horse, feline, and porcine IL-5, respectively, and shows cross-reactivity with human IL-5 receptors. IL-5 is predominantly produced by CD4+ Th2 cells, but can also be produced by activated eosinophils, mast cells, EBV-transformed B cells, Reed-Sternberg cells in Hodgkin's disease, and IL-2-stimulated invariant natural killer T cells (INKTs). IL-5 increases the production and mobilization of eosinophils and CD34+ progenitor cells in the bone marrow and promotes the maturation of eosinophil precursors outside the bone marrow. The human IL-5 receptor is predominantly expressed by eosinophils and is also present on basophils and mast cells, consisting of a unique ligand-binding subunit (IL-5Rα) and a common signal transduction subunit βc. IL-5Rα first binds to IL-5 with low affinity and then binds to a pre-formed β-dimer to form a high-affinity receptor.
Gene ID | 16191 |
Accession # | P04401 |
Alternate Names | IL5; IL-5; IL-5T-cell replacing factor; interleukin 5 (colony-stimulating factor; eosinophil); interleukin-5 |
Source | HEK293 |
Protein sequence | MEIPMSTVVKETLTQLSAHRALLTSNETMRLPVPTHKNHQLCIGEIFQGLDILKNQTVRGGTVEMLFQNLSLIKKYIDRQKEKCGEERRRTRQFLDYLQEFLGVMSTEWAMEG |
M.Wt | The protein has a calculated MW of 13.1 KDa |
Appearance | Solution protein. |
Stability & Storage | Avoid repeated freeze-thaw cycles. It is recommended that the protein be aliquoted for optimal storage. 3 years from date of receipt, -20 to -70 °C as supplied. |
Concentration | 1 mg/mL |
Formulation | Supplied as a 0.2 μm filtered solution in PBS, pH7.4. |
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. This solution can be diluted into other aqueous buffers. |
Biological Activity | Fully biologically active as determined by a cell proliferation assay using TF-1 human erythroleukemic cells. The EC50 for this effect is 0.01-0.25 ng/mL. |
Shipping Condition | Shipping with dry ice. |
Usage | For Research Use Only! Not to be used in humans. |
Quality Control & DataSheet
- View current batch:
-
Purity > 95 % by SDS-PAGE
- Datasheet
Endotoxin: Less than 1.0 EU/μg as determined by LAL method.