Recombinant Mouse IL-4 (His, Strep)
Interleukin 4 (IL-4), also known as B cell stimulating factor-1, is a monomeric Th2 cytokine that exhibits pleiotropy in the immune response. The amino acid sequence homology of mature mouse IL-4 was 39%, 39% and 59% with bovine, human and rat IL-4, respectively. IL-4 activity in human, mouse, and rat is species-specific. IL-4 functions through two receptor complexes. Type I receptors expressed on hematopoietic cells are ligand-bound IL-4Rα and common γ heterodimers. Type II receptors on non-hematopoietic cells are composed of IL-4Rα and IL-13Rα1. Type II receptors also transmit IL-13-mediated signaling. IL-4 is predominantly expressed by Th2-biased CD4+ T cells, mast cells, basophils, and eosinophils. It can promote the proliferation and survival of mouse B cells and the conversion of immunoglobulins to IgG1 and IgE, promote the acquisition of Th2 phenotype by na?ve CD4+ T cells, promote the initiation and chemotaxis of mast cells, eosinophils and basophils, and the proliferation and activation of epithelial cells. IL-4 plays a leading role in the occurrence and development of allergic inflammation and asthma.
Gene ID | 16189 |
Accession # | P07750 |
Alternate Names | B cell growth factor 1; BCDF; BCGF1; BCGF-1; binetrakin; BSF1; BSF-1; IL4; IL-4 |
Source | HEK293 |
Protein sequence | HIHGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIMQMDYS |
M.Wt | The protein has a calculated MW of 13.5 KDa |
Appearance | Solution protein. |
Stability & Storage | Avoid repeated freeze-thaw cycles. It is recommended that the protein be aliquoted for optimal storage. 3 years from date of receipt, -20 to -70 °C as supplied. |
Concentration | 1 mg/mL |
Formulation | Supplied as a 0.2 μm filtered solution in PBS, pH7.4. |
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. This solution can be diluted into other aqueous buffers. |
Biological Activity | Fully biologically active as determined by a cell proliferation assay using MC/9 mouse mast cells. The EC50 for this effect is 0.17 ng/mL. |
Shipping Condition | Shipping with dry ice. |
Usage | For Research Use Only! Not to be used in humans. |
Quality Control & DataSheet
- View current batch:
-
Purity > 95 % by SDS-PAGE
- Datasheet
Endotoxin: Less than 1.0 EU/μg as determined by LAL method.