Recombinant Mouse IL-3 (His, Flag)
Interleukin-3 (IL-3) is a type of biological signal (cytokine) which is encoded by the IL-3 gene located on chromosome 5 and produced primarily by activated T cells beside human thymic epithelial cells, activated murine mast cells, murine keratinocytes and neurons/astrocytes. The protein acts in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages. In addition, it exerts its biological activities through binding to interleukin-3 receptors included α and β subunits. The Mouse IL-3 is different from human IL-3 and contains 140 amino acids residues. Specifically, mouse and human IL-3 share low homology and have not cross species activity.
Reference:
1. Yang YC, Ciarletta AB, Temple PA, et al. 1986. Cell. 47:3-10.
2. Otsuka T, Miyajima A, Brown N, et al. 1988. J Immunol. 140:2288-95.
3. Miyatake S, Yokota T, Lee F, et al. 1985. Proc Natl Acad Sci U S A. 82:316-20.
4. Dorssers L, Burger H, Bot F, et al. 1987. Gene. 55:115-24.
| Gene ID | 16187 |
| Accession # | P01586 |
| Alternate Names | Hematopoietic?growth?factor;?MCGF;?Multipotential?colony-stimulating?factor;?P-cell-stimulating?factor |
| Source | CHO |
| Protein sequence | ASISGRDTHRLTRTLNCSSIVKEIIGKLPEPELKTDDEGPSLRNKSFRRVNLSKFVESQGEVDPEDRYVIKSNLQKLNCCLPTSANDSALPGVFIRDLDDFRKKLRFYMVHLNDLETVLTSRPPQPASGSVSPNRGTVEC |
| M.Wt | The protein has a calculated MW of 29.0 KDa. |
| Appearance | Solution protein |
| Stability & Storage | Use a manual defrost freezer and avoid repeated freeze-thaw cycles - 36 months from date of receipt, -20 to -70°C as supplied |
| Concentration | 1 mg/mL |
| Formulation | Supplied as a 0.2 μm filtered solution in PBS, pH7.4. |
| Biological Activity | Fully biologically active as determined by a cell proliferation assay using BaF3 mouse pro?B cells. The EC50 for this effect is 6.1 ng/mL. |
| Shipping Condition | Shipping with dry ice. |
| Usage | For Research Use Only! Not to be used in humans. |







