Recombinant Mouse IL-13 (His, Flag)
Interleukin 13 (IL-13) is a 17 kDa immunomodulatory cytokine that plays a key role in the pathogenesis of allergic asthma and atopic diseases. It is secreted by CD4+ T cells of Th1 and Th2, NK cells, visceral smooth muscle cells, eosinophils, mast cells, and basophils. IL-13 cycles as a monomer with two internal disulfide bonds that form a bundled configuration of four α-helix. The amino acid sequence homology of mature mouse IL-13 with human, rat and rhesus angelese IL-13 was 57%, 75% and 58%, respectively. Despite its low homology, it exhibits cross-species activity between human, mouse, and rats. IL-13 has different activity against a variety of cell types. On macrophages, IL-13 inhibits the production of pro-inflammatory cytokines and other cytotoxic substances. On B cells, IL-13 induces the conversion of immunoglobulins to IgE, upregulates the expression of MHC class II, CD71, CD72, and CD23, and synergistically stimulates proliferation. IL-13 upregulates IL-6 and downregulates IL-1 and TNF-α in fibroblasts and endothelial cells.
| Gene ID | 16163 |
| Accession # | P20109 |
| Alternate Names | ALRHMGC116789; BHR1interleukin-13; IL13; IL-13; IL-13MGC116788; interleukin 13 |
| Source | HEK293 |
| Protein sequence | APGPVPRSVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTVSSLPDTKIEVAHFITKLLSYTKQLFRHGPF |
| M.Wt | The protein has a calculated MW of 12.3 KDa |
| Appearance | Solution protein. |
| Stability & Storage | Avoid repeated freeze-thaw cycles. It is recommended that the protein be aliquoted for optimal storage. 3 years from date of receipt, -20 to -70 °C as supplied. |
| Concentration | 1 mg/mL |
| Formulation | Supplied as a 0.2 μm filtered solution in PBS, pH7.4. |
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. This solution can be diluted into other aqueous buffers. |
| Biological Activity | Fully biologically active as determined by a cell proliferation assay using TF-1 human erythroleukemic cells. The EC50 for this effect is 5.3 ng/mL. |
| Shipping Condition | Shipping with dry ice. |
| Usage | For Research Use Only! Not to be used in humans. |
Quality Control & DataSheet
- View current batch:
-
Purity > 95 % by SDS-PAGE
- Datasheet
Endotoxin: Less than 1.0 EU/μg as determined by LAL method.