Recombinant Mouse IFN-gamma (His, Strep)
Interferon-γ, also known as type II or immunointerferon, has a wide range of immunomodulatory activities and is considered the prototype of pro-inflammatory cytokines. Mature mouse interferon-γ exists as a non-covalently linked homodimer of 20-25 kDa variable glycosylated subunits. It has 86% amino acid sequence homology to rat interferon-γ and 38%-44% homology to cattle, dogs, cotton mice, horses, cats, humans, pigs, and rhesus macaques. The interferon-γ dimer binds to interferon-gamma RI (α subunit) and interacts with interferon-gamma RII (β subunit) to form a functional receptor complex consisting of two α and two β subunits. The inclusion of interferon-γRII increases binding affinity with ligands and the efficiency of signal transduction. Interferon-γ is produced by a variety of immune cells under inflammatory conditions, especially T cells and NK cells. It plays a key role in host defense by promoting the development and activation of Th1 cells, chemotaxis and activation of monocytes and macrophages, upregulation of antigen-presenting molecules, and conversion of immunoglobulins in B cells. It also exhibits antiviral, antiproliferative, and apoptotic effects. In addition, interferon-γ acts as an anti-inflammatory mediator by promoting the development of regulatory T cells and inhibiting the differentiation of Th17 cells. The pleiotropic effect of interferon-γ contributes to the multifaceted development of atherosclerosis.
Gene ID | 15978 |
Accession # | P01580 |
Alternate Names | IFG; IFI; IFNG; IFNgamma; IFN-gamma; Immune interferon; interferon gamma; interferon, gamma |
Source | HEK293 |
Protein sequence | HGTVIESLESLNNYFNSSGIDVEEKSLFLDIWRNWQKDGDMKILQSQIISFYLRLFEVLKDNQAISNNISVIESHLITTFFSNSKAKKDAFMSIAKFEVNNPQVQRQAFNELIRVVHQLLPESSLRKRKRSRC |
M.Wt | The protein has a calculated MW of 15.5 KDa |
Appearance | Solution protein. |
Stability & Storage | Avoid repeated freeze-thaw cycles. It is recommended that the protein be aliquoted for optimal storage. 3 years from date of receipt, -20 to -70 °C as supplied. |
Concentration | 1 mg/mL |
Formulation | Supplied as a 0.2 μm filtered solution in PBS, pH7.4. |
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. This solution can be diluted into other aqueous buffers. |
Biological Activity | Testing in progress. |
Shipping Condition | Shipping with dry ice. |
Usage | For Research Use Only! Not to be used in humans. |
Quality Control & DataSheet
- View current batch:
-
Purity > 95 % by SDS-PAGE
- Datasheet
Endotoxin: Less than 1.0 EU/μg as determined by LAL method.