Recombinant Mouse FIt-3 Ligand/FLT3L (His, Flag)
Mouse Fms-related tyrosine kinase 3 ligand (Flt3 ligand or Flt3L, also known as SL cytokine and CD135L) is a single-pass type I membrane protein encoded by the Flt3lg gene. Structurally, its core domain consists of a four-helical cytokine core. As a key hematopoietic regulator, Flt3 ligand primarily functions by activating its receptor FLT3 and synergizing with other cytokines (such as GM-CSF, G-CSF, and IL-3) to stimulate the proliferation and differentiation of early hematopoietic progenitor cells, with particularly crucial roles in the development of lymphoid progenitors, natural killer cells, B cells, and dendritic cells. Consequently, this recombinant protein is widely used in cell culture research, for example, to expand hematopoietic progenitor cells or induce dendritic cells, thereby supporting studies in immunology and cancer immunotherapy.
| Gene ID | 14256 |
| Accession # | P49772 |
| Alternate Names | Fms-related tyrosine kinase 3 ligand, Flt3 ligand, Flt3L, SL cytokine |
| Source | HEK293 |
| Protein sequence | GTPDCYFSHSPISSNFKVKFRELTDHLLKDYPVTVAVNLQDEKHCKALWSLFLAQRWIEQLKTVAGSKMQTLLEDVNTEIHFVTSCTFQPLPECLRFVQTNISHLLKDTCTQLLALKPCIGKACQNFSRCLEVQCQPDSSTLLPPRSPIALEATELPEPRPRQ |
| M.Wt | The protein has a calculated MW of 20.6 KDa. |
| Appearance | Solution protein |
| Stability & Storage | Use a manual defrost freezer and avoid repeated freeze-thaw cycles - 36 months from date of receipt, -20 to -70°C as supplied |
| Concentration | 1 mg/mL |
| Formulation | Supplied as a 0.2 μm filtered solution in PBS, pH7.4. |
| Biological Activity | Fully biologically active as determined by a cell proliferation assay using BaF3 mouse pro?B cells transfected with human Flt-3. The EC50 for this effect is 0.1-1 ng/mL. |
| Shipping Condition | Shipping with dry ice. |
| Usage | For Research Use Only! Not to be used in humans. |






