Recombinant Human VEGF 165, Tag Free
Vascular Endothelial Growth Factor is a sub-family of growth factors produced by cells, which stimulates vasculogenesis and angiogenesis. VEGF's normal function is to create new blood vessels during embryonic development, new blood vessels after injury, muscle following exercise, and new vessels (collateral circulation) to bypass blocked vessels. Humans express alternately spliced isoforms of 121, 145, 165, 183, 189, and 206 amino acids (a.a.) in length. VEGF production can be induced in cells that are not receiving enough oxygen. VEGF165 appears to be the most abundant and potent isoform, followed by VEGF121 and VEGF189. Recombinant human VEGF165 contains 165 amino acids residues and it is a disulfide-linked homodimer. In addition, it shares 88 % a.a. with corresponding regions of mouse and rat, 96 % with porcine, 95 % with canine, and 93 % with feline, equine and bovine VEGF, respectively
Reference:
1. Leung DW, Cachianes G, Kuang WJ, et al. 1989. Science. 246:1306-9
2. Byrne AM, Bouchier-Hayes DJ, Harmey JH. 2005. J Cell Mol Med. 9:777-94
3. Robinson CJ, Stringer SE. 2001. J Cell Sci. 114:853-65.
| Gene ID | 7422 |
| Accession # | P15692 |
| Alternate Names | Vascular?Endothelial?Growth?Factor?Isoform?165 |
| Source | E.coli |
| Protein sequence | MAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGG CCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGP CSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR |
| M.Wt | The protein has a calculated MW of 19.2 KDa. |
| Appearance | Solution protein |
| Stability & Storage | Use a manual defrost freezer and avoid repeated freeze-thaw cycles - 36 months from date of receipt, -20 to -70°C as supplied |
| Concentration | 1 mg/mL |
| Formulation | Supplied as a 0.2 μm filtered solution in PBS, pH7.4. |
| Biological Activity | Testing in progress. |
| Shipping Condition | Shipping with dry ice. |
| Usage | For Research Use Only! Not to be used in humans. |