Recombinant Human PDGF-BB (Tag Free, E.coli)
Platelet-derived growth factor BB (PDGF-BB) is a member of the PDGF family and is a disulfide-linked homodimer. The PDGF family consists of proteins PDGF-A and PDGF-B that form three disulfide-linked homodimers (PDGF-AA, -BB, and -AB). PDGF is stored in platelet α-granules and released upon platelet activation. PDGF signaling is transmitted through the receptors PDGFR-α and PDGFR-β. PDGFR-α is a high-affinity receptor for each of the three PDGF forms. However, PDGFR-β interacts only with PDGF-BB and PDGF-AB. PDGF-BB is a potent mitogen for many cell types, including smooth muscle cells, connective tissue cells, bone and cartilage cells, and some blood cells. Recombinant human PDGF-BB is a 24.3 kDa B-chain homodimeric protein formed from 109-amino-acid subunits.
| Gene ID | 5155 |
| Accession # | P01127-1 |
| Alternate Names | PDGFB, c-sis, SIS, SSV, IBGC5, PDGF2, PDGF-2, PDGF subunit B, Platelet-derived growth factor subunit B |
| Source | E.coli |
| Protein sequence | SLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVT |
| M.Wt | Approximately 12.2 kDa |
| Appearance | Solution protein |
| Stability & Storage | Avoid repeated freeze-thaw cycles. It is recommended that the protein be aliquoted for optimal storage. -3 years from date of receipt, -20 to -70°C as supplied. |
| Concentration | 1 mg/mL |
| Formulation | Supplied as a 0.2 μm filtered solution in PBS, pH7.4. |
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. This solution can be diluted into other aqueous buffers. |
| Biological Activity | Fully biologically active as determined by a cell proliferation assay using Balb/3T3 cells . The EC50 for this effect is 27 ng/mL. |
| Shipping Condition | Shipping with dry ice. |
| Handling | Centrifuge the vial prior to opening. |
| Usage | For Research Use Only! Not to be used in humans. |