Recombinant Human Noggin (His, Flag)
Noggin encoded by the NOG gene, was first isolated from Xenopus, having the function of inducing secondary axis formation in frog embryos. It inhibits TGF-β family ligands and preventing them from binding to their corresponding receptors. Noggin was originally found as a BMP-4 antagonist, and then has been shown to modulate the activities of other BMPs (BMP-2, 7, 13 and 14). Additionally, it has pleiotropic effect, both in early development and later stages. The results of the mouse knockout of noggin suggest that it is involved in numerous developmental processes, such as neural tube fusion and joint formation. In recent report, proximal symphalangism (SYM1) and multiple synostoses syndrome (SYNS1) have relation with the mutant of evolutionarily conserved amino acid residues of Noggin. Mature human Noggin shares 99 %, 99 %, 98 %, 97 % and 89 % a.a. sequence identity with mouse, rat, bovine, equine and chicken Noggin, respectively.
Reference:
1. Davis SWandCamper SA. 2007. Dev Biol, 305: 145-60.
2. Zhu W, Kim J, Cheng C, et al. 2006. Bone, 39: 61-71.
3. Oxley CD, Rashid R, Goudie DR, et al. 2008. Horm Res, 69: 221-6.
4. Bayramov AV, Eroshkin FM, Martynova NY, et al. 2011. Development, 138: 5345-56.
5. Secondini C, Wetterwald A, Schwaninger R, et al. 2011. PLoS One, 6: e16078.
| Gene ID | 9241 |
| Accession # | Q13253 |
| Alternate Names | NOGG_HUMAN, NOG |
| Source | HEK293 |
| Protein sequence | QHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC |
| M.Wt | The protein has a calculated MW of 23.04 KDa. |
| Appearance | Solution protein |
| Stability & Storage | Use a manual defrost freezer and avoid repeated freeze-thaw cycles - 36 months from date of receipt, -20 to -70°C as supplied |
| Concentration | 1 mg/mL |
| Formulation | Supplied as a 0.2 μm filtered solution in PBS, pH7.4. |
| Biological Activity | Testing in progress. |
| Shipping Condition | Shipping with dry ice. |
| Usage | For Research Use Only! Not to be used in humans. |







