Recombinant Human Lipocalin-2 (His)
Catalog No.
PH1019
Recombinant Human Lipocalin-2
Featured Products
Lipocalin-2 is an acute-phase protein involved in iron metabolism and inflammatory responses. Recombinant Human Lipocalin-2 is used for the research of inflammatory diseases and metabolic syndrome.
| Gene ID | 3934 |
| Accession # | P80188 |
| Alternate Names | NGAL |
| Source | HEK293 |
| Protein sequence | QDSTSDLIPAPPLSKVPLQQNFQDNQFQGKWYVVGLAGNAILREDKDPQKMYATIYELKEDKSYNVTSVLFRKKKCDYWIRTFVPGCQPGEFTLGNIKSYPGLTSYLVRVVSTNYNQHAMVFFKKVSQNREYFKITLYGRTKELTSELKENFIRFSKSLGLPENHIVFPVPIDQCIDG |
| M.Wt | The protein has a calculated MW of 20.5 KDa |
| Appearance | Solution protein. |
| Stability & Storage | Avoid repeated freeze-thaw cycles. It is recommended that the protein be aliquoted for optimal storage. 3 years from date of receipt, -20 to -70 °C as supplied. |
| Concentration | 1 mg/mL |
| Formulation | Supplied as a 0.2 μm filtered solution in PBS, pH7.4. |
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. This solution can be diluted into other aqueous buffers. |
| Biological Activity | Fully biologically active as determined by its ability to bind Iron(III) dihydroxybenzoic acid [Fe(DHBA)3] within 30 min at room temperature. The binding of Fe(DHBA)3 results in the quenching of Trp fluorescence in Lipocalin-2. Recombinant human Lipocalin-2 (2 µM) can bind more than 1.5 µM of Fe(DHBA)3 under these conditions. |
| Shipping Condition | Shipping with dry ice. |
Quality Control & DataSheet
- View current batch:
-
Purity > 95 % by SDS-PAGE
- Datasheet
Endotoxin: Less than 1.0 EU/μg as determined by LAL method.