Recombinant Human IL-9 (His, Strep)
Interleukin-9 (IL-9) is encoded by the IL9 gene and is produced by T cells, specifically CD4+ helper cells. IL-9 was initially identified as a cytokine found in conditioned media for human T-cell leukemia virus type I (HTLVI)-transformed T cell lines. It functions through the IL-9 receptor, which activates different signal transducer and activator (STAT) proteins, linking this cytokine to various biological processes. IL-9 can support the growth of IL-2-independent and IL-4-independent helper T cells. Human IL-9 shares approximately 56% amino acid sequence identity with mouse IL-9. The gene encoding this cytokine has been identified as a candidate gene for asthma. Genetic studies in mouse models of asthma have shown that this cytokine is a determinant of bronchial hyperresponsive pathogenesis.
| Gene ID | 3578 |
| Accession # | P15248 |
| Alternate Names | Human IL9; IL9; IL-9; interleukin 9; Cytokine P40; HP40 |
| Source | HEK293 |
| Protein sequence | QGCPTLAGILDINFLINKMQEDPASKCHCSANVTSCLCLGIPSDNCTRPCFSERLSQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALTFLKSLLEIFQKEKMRGMRGKI |
| M.Wt | The protein has a calculated MW of 14.1 KDa |
| Appearance | Solution protein. |
| Stability & Storage | Avoid repeated freeze-thaw cycles. It is recommended that the protein be aliquoted for optimal storage. 3 years from date of receipt, -20 to -70 °C as supplied. |
| Concentration | 1 mg/mL |
| Formulation | Supplied as a 0.2 μm filtered solution in PBS, pH7.4. |
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. This solution can be diluted into other aqueous buffers. |
| Biological Activity | Fully biologically active as determined by a cell proliferation assay using MO7e human megakaryocytic leukemic cells. The EC50 for this effect is 0.95 ng/mL. |
| Shipping Condition | Shipping with dry ice. |
Quality Control & DataSheet
- View current batch:
-
Purity > 95 % by SDS-PAGE
- Datasheet
Endotoxin: Less than 1.0 EU/μg as determined by LAL method.