Recombinant Human IL-7 (His, Strep)
Interleukin-7 (IL-7) is a 25 kDa hematopoietic family cytokine that plays an important role in lymphocyte differentiation, proliferation, and survival. Human IL-7 cDNA encodes 177 amino acids (aa), including 25 aa signal peptides. Human IL-7 has approximately 60-63% aa sequence identity with mouse, rat, canine, and feline IL-7, and 72-76% with equine, cattle, sheep, pig, cat, and canine IL-7. Human and mouse IL-7 exhibit cross-species activity. IL-7 protein is produced by a variety of cells in primary and secondary lymphoid tissues, including stromal epithelial cells of the thymus, bone marrow, and intestine. Circulating IL-7 protein is limited in healthy animals but increases during lymphopenia. IL-7 signals through a complex of the IL-7 receptor α subunit (IL-7 Rα, also known as CD127) with the common γ chain (γc). IL-7 contributes to the maintenance of all na?ve and memory T cells, primarily by promoting the expression of the anti-apoptotic protein Bcl-2. It is required for optimal T cell-dendritic cell interactions. IL-7 is expressed early in B cell development prior to the appearance of surface IgM. In mice, IL-7 activation of IL-7 Rα is essential for both the development of both T cells and B cell lineages, whereas in humans it is essential for T cells but not for B cell development. However, IL-7 has the function of inhibiting premature Ig light chain recombination during proliferative growth in both mouse and human B protocytes.
Gene ID | 3574 |
Accession # | P13232 |
Alternate Names | LP-1; pre-B cell factor |
Source | LP-1; pre-B cell factor |
Protein sequence | DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH |
M.Wt | The protein has a calculated MW of 17.3 KDa |
Appearance | Solution protein. |
Stability & Storage | Avoid repeated freeze-thaw cycles. It is recommended that the protein be aliquoted for optimal storage. 3 years from date of receipt, -20 to -70 °C as supplied. |
Concentration | 1 mg/mL |
Formulation | Supplied as a 0.2 μm filtered solution in PBS, pH7.4. |
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. This solution can be diluted into other aqueous buffers. |
Biological Activity | Fully biologically active as determined by a cell proliferation assay using PHA-activated human peripheral blood lymphocytes (PBL). The EC50 for this effect is 1 ng/mL. |
Shipping Condition | Shipping with dry ice. |
Usage | For Research Use Only! Not to be used in humans. |
Quality Control & DataSheet
- View current batch:
-
Purity > 95 % by SDS-PAGE
- Datasheet
Endotoxin: Less than 1.0 EU/μg as determined by LAL method.