Recombinant Human IL-6, Tag Free
Interleukin-6 (IL-6) is an interleukin that in humans is encoded by the IL-6 gene and acts as both a pro-inflammatory and anti-inflammatory cytokine. It is secreted by T cells and macrophages to stimulate immune response. Furthermore, It plays an essential role in the final differentiation of B-cells into Ig-secreting cells involved in lymphocyte and monocyte differentiation. It also induces myeloma and plasmacytoma growth and induces nerve cells differentiation acts on B-cells, T-cells, hepatocytes, hematopoietic progenitor cells and cells of the CNS. The human IL-6 is a single non-glycosylated polypeptide chain containing 183 amino acids and it signals through a cell-surface type I cytokine receptor complex consisting of the ligand-binding IL-6Rα chain (CD126), and the signal- transducing component gp130 (also called CD130). The human IL-6 shares about 40% a.a. sequence identity with mouse and rat IL-6 and it is equally active on mouse and rat cells.
Reference:
1. Ferguson-Smith AC, Chen YF, Newman MS, et al. 1988. Genomics. 2:203-8
2. van der Poll T, Keogh CV, Guirao X, et al. 1997. J Infect Dis. 176:439-44
3. Ming JE, Cernetti C, Steinman RM, et al. 1989. J Mol Cell Immunol. 4:203-11; discussion 211-2
4. Bastard JP, Jardel C, Delattre J, et al. 1999. Circulation. 99:2221-2
5. Heinrich PC, Behrmann I, Muller-Newen G, et al. 1998. Biochem J. 334 ( Pt 2):297-314.
| Gene ID | 3569 |
| Accession # | P05231 |
| Alternate Names | BSF-2;?CDF;?Hybridoma?growth?factor;?IFN-beta-2 |
| Source | E.coli |
| Protein sequence | VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENN |
| M.Wt | The protein has a calculated MW of 6.6 KDa. |
| Appearance | Solution protein |
| Stability & Storage | Use a manual defrost freezer and avoid repeated freeze-thaw cycles - 36 months from date of receipt, -20 to -70°C as supplied |
| Concentration | 1 mg/mL |
| Formulation | Supplied as a 0.2 μm filtered solution in PBS, pH7.4. |
| Biological Activity | Fully biologically active as determined by a cell proliferation assay using MM.1S cells. The EC50 for this effect is 0.1 ng/mL. |
| Shipping Condition | Shipping with dry ice. |
| Usage | For Research Use Only! Not to be used in humans. |






