Recombinant Human IL-3 (His, Flag)
Interleukin-3 (IL-3) is a potent growth-promoting cytokine that belongs to the IL-3 family. IL3/IL-3 also belongs to the interleukin class. Interleukins are produced by a variety of body cells. The function of the immune system is largely dependent on interleukins, and some of the rare defects of interleukins have been described, all of which are characterized by autoimmune diseases or immunodeficiencies. Most interleukins are synthesized by helper CD4+ T lymphocytes as well as monocytes, macrophages, and endothelial cells. They promote the development and differentiation of T, B, and hematopoietic cells. IL3/IL-3 supports the proliferation of a variety of hematopoietic cell types. It is involved in a variety of cellular activities like cell growth, differentiation, and apoptosis. IL3/IL-3 also has neurotrophic activity and may be associated with neurological disorders.
| Gene ID | 3562 |
| Accession # | P08700-1 |
| Alternate Names | Hematopoietic growth factor; MCGF; Multipotential colony-stimulating factor; P-cell-stimulating factor |
| Source | HEK293 |
| Protein sequence | APMTQTTSLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDPGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF |
| M.Wt | The protein has a calculated MW of 15.1 KDa |
| Appearance | Solution protein. |
| Stability & Storage | Avoid repeated freeze-thaw cycles. It is recommended that the protein be aliquoted for optimal storage. 3 years from date of receipt, -20 to -70 °C as supplied. |
| Concentration | 1 mg/mL |
| Formulation | Supplied as a 0.2 μm filtered solution in PBS, pH7.4. |
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. This solution can be diluted into other aqueous buffers. |
| Biological Activity | Fully biologically active as determined by a cell proliferation assay using TF-1 human erythroleukemic cells. The EC50 for this effect is 0.4 ng/mL. |
| Shipping Condition | Shipping with dry ice. |
| Usage | For Research Use Only! Not to be used in humans. |
Quality Control & DataSheet
- View current batch:
-
Purity > 95 % by SDS-PAGE
- Datasheet
Endotoxin: Less than 1.0 EU/μg as determined by LAL method.







