Recombinant Human IL-28A/IFN-lambda 2 (His, Flag)
Mouse Interferon lambda-2 (IFN-λ-2), also known as Interleukin-28A (IL-28A), is a cytokine with antiviral, antitumor, and immunomodulatory activities encoded by the Ifnl2 gene (also known as Il28a). Functionally, IFN-λ-2 acts as a ligand for the heterodimeric class II cytokine receptor composed of IL10RB and IFNLR1, activating the JAK/STAT signaling pathway to induce the expression of interferon-stimulated genes, thereby mediating an antiviral state. Because its receptor IFNLR1 is primarily expressed in epithelial cells, the action of this cytokine exhibits epithelial tissue specificity, playing an important role in the antiviral immune defense of the intestinal epithelium, and exerting immunomodulatory effects by upregulating MHC class I antigen expression. Based on these properties, recombinant mouse IFN-λ-2 protein can be used in research fields such as antiviral mechanisms in epithelial tissues, immunomodulation, and the tumor microenvironment.
| Gene ID | 330496 |
| Accession # | Q4VK74 |
| Alternate Names | Interferon lambda-2, Interleukin-28A, IFN-lambda-2 |
| Source | HEK293 |
| Protein sequence | MKLDMTGDCTPVLVLMAAVLTVTGAVPVARLHGALPDARGCHIAQFKSLSPQELQAFKRAKDALEESLLLKDCRCHSRLFPRTWDLRQLQVRERPMALEAELALTLKVLEATADTDPALVDVLDQPLHTLHHILSQFRACIQPQPTAGPRTRGRLHHWLYRLQEAPKKESPGCLEASVTFNLFRLLTRDLNCVASGDLCV |
| M.Wt | The protein has a calculated MW of 25.2 KDa. |
| Appearance | Solution protein |
| Stability & Storage | Use a manual defrost freezer and avoid repeated freeze-thaw cycles - 36 months from date of receipt, -20 to -70°C as supplied |
| Concentration | 1 mg/mL |
| Formulation | Supplied as a 0.2 μm filtered solution in PBS, pH7.4. |
| Biological Activity | Fully biologically active as determined by detecting the firefly luciferase activity in HEK293 cells transfected with pISRE_TA_Luc and IL-28 R alpha and IL-10 R beta. The EC50 for this effect is 16.3 ng/mL. |
| Shipping Condition | Shipping with dry ice. |
| Usage | For Research Use Only! Not to be used in humans. |







