Recombinant Human IL-1 beta (His, Strep)
Interleukin 1β (IL1β or IL1B), also known as catabolin, is a member of the interleukin 1 family of cytokines. IL1 refers to two pleiotropic cytokines, IL-1α (IL-1F1) and IL-1β (IL-1F2), which are products of different genes. IL-1α and IL-1β are structurally related peptides that share about 21% amino acid (aa) identity in humans. Both proteins are produced by a wide variety of cells in response to inflammatory factors, infections, or microbial endotoxins. While IL-1α and IL-1β are independently regulated, they bind to the same receptor and exert the same biological role. IL-1RI binds directly to IL-1α or IL-1β and then to the IL-1R accessory protein (IL-1R3/IL-1RAcP) to form a high-affinity receptor complex capable of signal transduction. IL-1RII has a high affinity for IL-1β but acts as a decoy receptor and a negative regulator of IL-1β activity. Human IL-1β cDNA encodes a precursor of 269 amino acids. The cysteine protease IL-1β convertase (Caspase-1/ICE) cleaves the 116aa propeptide intracellularly to produce active cytokines [5-7]. The 17 kDa mature human IL-1β has 96% aa sequence homology with rhesus macaques and 67%-78% aa sequence homology with dogs, cotton mice, horses, cats, mice, pigs, and rats.
Gene ID |
3553 |
Accession # |
P01584 |
Alternate Names |
Human IL1 beta; IL-1 beta; IL-1; IL-1b; IL1-BETA; IL-1F2; IL-1 beta; interleukin-1 beta |
Source |
HEK293 |
Protein sequence |
APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS |
Tag |
C-His, C-Strep |
M.Wt |
The protein has a calculated MW of 17.4 kDa. |
Appearance |
Solution protein. |
Stability & Storage |
Avoid repeated freeze-thaw cycles. It is recommended that the protein be aliquoted for optimal storage. |
Concentration |
1 mg/mL |
Formulation |
Supplied as a 0.2 μm filtered solution in PBS, pH7.4. |
Reconstitution |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. This solution can be diluted into other aqueous buffers. |
Biological Activity |
Testing in progress. |
Shipping Condition |
Shipping with dry ice. |
Handling |
Centrifuge the vial prior to opening. |
Usage |
For Research Use Only! Not to be used in humans. |
Quality Control & DataSheet
- View current batch:
-
Purity > 95 % by SDS-PAGE.
- Datasheet
Endotoxin: Less than 1.0 EU/µg as determined by LAL method.