Recombinant Human CD24 Fc Chimera Protein, Insect Cells Derived
CD24, also known as Heat-Stable Antigen and Nectadrin, is a heavily and variably glycosylated 30 kDa-60 kDa GPI-linked sialoprotein. Human CD24 is expressed on B lineage cells and granulocytes, on epithelial, neuronal, and muscle cells, and on a range of tumor cells. In mouse, CD24 is even more widely expressed, particularly on T cells, monocytes, and dendritic cells. CD24 expression is regulated during lineage development and with the activation of various cell types. Antibody crosslinking of CD24 enhances the induction of apoptosis in B and T lymphocytes which contributes to negative selection and the induction of immune tolerance. CD24 on antigen presenting cells cooperates with B7 molecules in the costimulation of T cells. CD24 associates in cis with Siglec-10 (or Siglec-G in mouse) and with the danger-associated molecules HMGB1, HSP70, or HSP90 which are released from necrotic or damaged cells. Formation of these ternary complexes fills a protective role: the resulting Siglec-10 signaling inhibits inflammatory responses that are otherwise induced by extracellular DAMPs. Mature human CD24 shares 30% and 42% amino acid sequence identity with mouse and rat CD24, respectively.
| Source | Insect Cell |
| M.Wt | The protein has a calculated MW of 30.4 kDa, containing 276 amino acids. The protein migrates as 40-50 kDa in SDS-PAGE under reducing condition due to glycosylation. |
| AA Sequence | AGMGMSETTTGTSSNSSQSTSNSGLAPNPTNATTKAAGIEGRMDEPKSSDKTHTCPPCPAPEFEGAPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPTPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDK |
| Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Stability & Storage | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. - 12 months from date of receipt, -20 to -70 °C as supplied. - 1 month, 2 to 8 °C under sterile conditions after reconstitution. - 3 months, -20 to -70 °C under sterile conditions after reconstitution. |
| Formulation | Lyophilized from a 0.2 μm filtered concentrated solution in PBS. |
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions. |
| Biological Activity | Testing in progress. |
| Shipping Condition | Gel pack. |
| Handling | Centrifuge the vial prior to opening. |
| Usage | For Research Use Only! Not to be used in humans. |
Quality Control & DataSheet
- View current batch:
-
Purity > 95 % by SDS-PAGE analyses.
- Datasheet
Endotoxin: Less than 0.1 EU/μg of rHuCD24-Fc as determined by LAL method.






