Recombinant Human BD-3 (N-His)
Defensins (α and β) are cationic peptides with antimicrobial activity against Gram-negative and Gram-positive bacteria, fungi, and enveloped viruses. They are 2–6 kDa proteins that play an important role in the innate immune system. Based on the size and pattern of disulfide bonds, mammalian defensins are divided into three classes: α, β, and θ. β-defensins contain a six-cysteine motif that forms three intramolecular disulfide bonds. Four human β-defensins have been identified, and they are expressed in some leukocytes and on epithelial surfaces. Because β-defensins are cationic peptides, they can interact with the membranes of invading microorganisms, which are negatively charged due to lipopolysaccharide (LPS) and lipoteichoic acid (LTA) in the cell membrane. In particular, they have a higher affinity for binding sites compared with Ca2+ and Mg2+ ions. In addition, they affect membrane stability.
Reference:
1. Lioi AB, Reyes Rodriguez AL, Funderburg NT, et al. 2012. J Leukoc Biol, 92: 1083-91.
2. Wang K, Wang JH, Baskaran H, et al. 2012. Head Neck Oncol, 4: 41.
3. Lee JK, Park YJ, Kum KY, et al. 2013. Int Endod J, 46(5):406-12.
| Gene ID | 55894 |
| Accession # | P81534 |
| Alternate Names | DEFB103A, DEFB103B, DEFB3, HBD-3, hBD-3, Beta-defensin 3, BD-3, BD3, DEFB-3, Defensin beta 103A |
| Source | E.coli |
| Protein sequence | MGHHHHHHHHGSSLEVLFQGPGIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK |
| M.Wt | Approximately 7.5 kDa |
| Appearance | Solution protein |
| Stability & Storage | Avoid repeated freeze-thaw cycles. It is recommended that the protein be aliquoted for optimal storage. -3 years from date of receipt, -20 to -70°C as supplied. |
| Concentration | 1 mg/mL |
| Formulation | Supplied as a 0.2 μm filtered solution in PBS, pH7.4. |
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. This solution can be diluted into other aqueous buffers. |
| Biological Activity | Fully biologically active as determined by anti-microbial activity against E.coli.The ED50 for this effect is 3.3 μg/ml. |
| Shipping Condition | Shipping with dry ice. |
| Handling | Centrifuge the vial prior to opening. |
| Usage | For Research Use Only! Not to be used in humans. |