Recombinant Haemonchus contortus HcES-15 (N-His)
Haemonchus contortus 15 kDa excretory/secretory protein (HcES-15) is a small molecule protein secreted by the barber pole worm. This protein belongs to the identified components of Haemonchus contortus excretory/secretory products (ESPs) and, together with Hc24 and Hc40, is regarded as an immunogenic component with vaccine development potential. Its functional research mainly focuses on the immunomodulatory activity of HcES-15: this protein can upregulate host IL-17, IL-4, and IL-10 production. The peptide ES15-1 designed based on HcES-15 can activate the STAT3/RORγt pathway in goat peripheral blood mononuclear cells (PBMCs) in vitro and induce IL-17 production; in goat immune protection experiments, PLGA-encapsulated ES15-1 reduced fecal egg counts by 69.0% and adult worm burden by 50.54%, demonstrating its potential as a candidate antigen for an anti-Haemonchus contortus vaccine. In addition, proteomic studies found that Hc15 exhibits extensive sequence variation in excretory/secretory products (multiple amino acid substitutions and differences in N-terminal cleavage), and different Hc15 isoforms are recognized by hyperimmune sera to significantly different degrees, suggesting that it may play a specific role during infection or immune evasion.
| Gene ID | AY821552.1 |
| Accession # | AAV84000.1 |
| Alternate Names | 15 kDa ES, 15 kDa excretory/secretory protein, rHcES-15 |
| Source | E.coli |
| Protein sequence | MFFAFAVLLIALATREAYGSGNREMFENINKEYNTHLKWDDDLAAKA |
| M.Wt | Approximately 27.2 kDa |
| Appearance | Solution protein |
| Stability & Storage | Avoid repeated freeze-thaw cycles. It is recommended that the protein be aliquoted for optimal storage. -3 years from date of receipt, -20 to -70°C as supplied. |
| Concentration | 0.3 mg/mL |
| Formulation | Supplied as a 0.2 μm filtered solution in PBS, pH7.4. |
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. This solution can be diluted into other aqueous buffers. |
| Biological Activity | Promotes goat IL-17, IL-1, TNF-α, IL-6, IL-12, and IFN-γ; inhibits goat IL-4 and TGF-β. |
| Shipping Condition | Shipping with dry ice. |
| Handling | Centrifuge the vial prior to opening. |
| Usage | For Research Use Only! Not to be used in humans. |
Related Biological Data
Related Biological Data
