Recombinant Chicken IL-9 (N-His)
Chicken interleukin-9 (Gallus gallus Interleukin-9, Chicken IL-9) is a secreted pleiotropic cytokine belonging to the IL-7/IL-9 family. Unlike mammalian IL-9, chicken IL-9 was cloned and functionally characterized relatively late: a 2022 study first cloned chicken IL-9 and found that its amino acid identity with mammalian IL-9 is less than 30%. Chicken IL-9 mRNA is abundantly detected only in the testis and thymus, and is significantly upregulated in mitogen-stimulated peripheral blood mononuclear cells (PBMCs); native chicken IL-9 is expressed as a glycosylated protein in activated PBMCs with a molecular weight of approximately 25 kD. Functionally, recombinant chicken IL-9 activates monocytes/macrophages to produce inflammatory cytokines and promotes CD3+ T cell proliferation, suggesting conserved pro-inflammatory and pro-proliferative activities in avian immune regulation.
| Gene ID | 001037825.1 |
| Accession # | C4PAQ5 |
| Alternate Names | Chicken IL-9, IL9, Interleukin-9, P40, HP40, Cytokine P40, T-cell growth factor P40 |
| Source | E.coli |
| Protein sequence | RGSQNCQVSEIIRNTRSLLNKTQESCPCRETAATPCSCLPIPEPGHELACFVEGTKHMLEHNMTSNIKLLLLNQSFQIQRDRNLCESLTRGKKCEYKTKGTVRTFLEKILKTYQEIHKSRVAAA |
| M.Wt | Approximately 18.4 kDa |
| Appearance | Solution protein |
| Stability & Storage | Avoid repeated freeze-thaw cycles. It is recommended that the protein be aliquoted for optimal storage. -3 years from date of receipt, -20 to -70°C as supplied. |
| Concentration | 5 mg/mL |
| Formulation | Supplied as a 0.2 μm filtered solution in PBS, pH7.4. |
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. This solution can be diluted into other aqueous buffers. |
| Biological Activity | Significantly downregulates IL-10 mRNA levels; significantly upregulates IL-2, IL-4, IL-17A, IFN-γ, and TGF-β1 mRNA levels; significantly upregulates IL-1β, IL-6, and TNF-α mRNA levels. |
| Shipping Condition | Shipping with dry ice. |
| Handling | Centrifuge the vial prior to opening. |
| Usage | For Research Use Only! Not to be used in humans. |
Related Biological Data
Related Biological Data
