Exendin-3 (9-39) amide
Catalog No.
B6943
GLP-1 receptor antagonist
Featured Products
- 1. Yizhong Peng, Hui Lin, et al. "Glucagon-like peptide-1 receptor activation maintains extracellular matrix integrity by inhibiting the activity of mitogen-activated protein kinases and activator protein-1." Free Radic Biol Med. 2021 Dec;177:247-259. PMID:34737144
- 2. Jie Wu, Pingfan Guo, et al. "Glucagon-like peptide-1 affects human umbilical vein endothelial cells in high glucose by the PI3K/Akt/eNOS signaling pathway." Turk J Biochem. 2017.09.11.
| Physical Appearance | A solid |
| Storage | Desiccate at -20°C |
| M.Wt | 3369.79 |
| Cas No. | 133514-43-9 |
| Formula | C149H234N40O47S |
| Solubility | ≥168.5 mg/mL in DMSO; ≥24.65 mg/mL in EtOH; ≥25.2 mg/mL in H2O |
| SDF | Download SDF |
| Canonical SMILES | DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2 |
| Shipping Condition | Small Molecules with Blue Ice, Modified Nucleotides with Dry Ice. |
| General tips | We do not recommend long-term storage for the solution, please use it up soon. |
Quality Control & MSDS
- View current batch:
Chemical structure

Related Biological Data








