Recombinant Mouse M-CSF/CSF1 (His, Flag)
Macrophage colony-stimulating factor (M-CSF), also known as CSF-1, is a quadruple α helical bundle cytokine that is the main regulator of macrophage survival, proliferation, and differentiation. The M-CSF protein is also essential for the survival and proliferation of osteoclast precursor cells. M-CSF also initiates and enhances macrophage killing of tumor cells and microorganisms, regulates the release of cytokines and other inflammatory modulators by macrophages, and stimulates phagocytosis. M-CSF is increased during pregnancy to support the implantation and growth of the decidua and placenta. Sources of M-CSF include fibroblasts, activated macrophages, endometrial secretory epithelium, bone marrow stromal cells, and activated endothelial cells. The macrophage colony-stimulating factor receptor (c-FMS) transduces its chemotaxis and mediates its endocytosis. The first 229 amino acids of mouse mature M-CSF have 87%, 83%, 82%, and 81% homology to the corresponding regions of rat, dog, bovine, and human M-CSF, respectively. Human M-CSF is active in mice, but M-CSF from mice has been reported to be species-specific.
Gene ID | 12977 |
Accession # | P07141 |
Alternate Names | colony stimulating factor 1 (macrophage); CSF1; CSF-1; MCSF; M-CSF |
Source | HEK293 |
Protein sequence | KEVSEHCSHMIGNGHLKVLQQLIDSQMETSCQIAFEFVDQEQLDDPVCYLKKAFFLVQDIIDETMRFKDNTPNANATERLQELSNNLNSCFTKDYEEQNKACVRTFHETPLQLLEKIKNFFNETKNLLEKDWNIFTKNCNNSFAKCSSRDVVTKPDCNCLYPKATPSSDPASASPHQPPAPSMAPLAGLAWDDSQRTEGSSLLPSELPLRIEDPGSAKQRPPRSTCQTLE |
M.Wt | The protein has a calculated MW of 25.9 KDa |
Appearance | Solution protein. |
Stability & Storage | Avoid repeated freeze-thaw cycles. It is recommended that the protein be aliquoted for optimal storage. 3 years from date of receipt, -20 to -70 °C as supplied. |
Concentration | 1 mg/mL |
Formulation | Supplied as a 0.2 μm filtered solution in PBS, pH7.4. |
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. This solution can be diluted into other aqueous buffers. |
Biological Activity | Fully biologically active as determined by a cell proliferation assay using M-NFS-60 mouse myelogenous leukemia lymphoblast cells. The EC50 for this effect is 1 ng/mL. |
Shipping Condition | Shipping with dry ice. |
Usage | For Research Use Only! Not to be used in humans. |
Quality Control & DataSheet
- View current batch:
-
Purity > 95 % by SDS-PAGE
- Datasheet
Endotoxin: Less than 1.0 EU/μg as determined by LAL method.