Recombinant Human FGF9
FGF-9 (fibroblast growth factor-9), also called HBGF-9 (heparin-binding growth factor-9) and GAF (glia-activating factor), is an approximately 26 kDa secreted glycoprotein of the FGF family [1-3]. FGFs exhibit heparin-dependent regulation of cell prolifer ation, differentiation, and function, and are characterized by a core heparin-binding FGF domain of approximately 120 amino acids (aa) that exhibits a beta -trefoil structure [1]. FGF-9, -16 and -20 form a subfamily that shares 65-71% aa sequence identity, binds FGF R3 (IIIb), and are efficiently secreted despite having an uncleavable, bipartite signal sequence [1-3]. Secreted human FGF-9 is a 205-207 aa protein that lacks the N-terminal 1-3 aa and shares 98% sequence identity with mouse, rat, equine, porcine and bovine FGF-9. In addition to FGF R3 (IIIb), FGF-9 binding to the IIIc splice forms of FGF R1, R2 and R3 are variably reported [3-5]. An unusual constitutive dimerization of FGF-9 buries receptor interaction sites which lowers its activity and increases heparin affinity which inhibits diffusion [4-6]. A spontaneous mouse mutant, Eks, interferes with dimerization, resulting monomeric, diffusible FGF-9 that causes elbow and knee synostoses (joint fusions) due to FGF-9 misexpression in developing joints [6]. In humans, FGF-9 mutations that lower receptor binding cause multiple synostoses syndrome (SYNS) [7]. Expression in brain and kidney are reported in the adult rat [2, 8]. In the mouse embryo the location and timing of FGF-9 expression affects development of the skeleton, cerebellum, lungs, heart, vasculature, digestive tract, and testes [1, 6-11]. Deletion of mouse FGF-9 is lethal at birth due to lung hypoplasia, and causes rhizomelia, or shortening of the proximal skeleton [1, 10, 11]. Altered FGF-9 expression or function is reported in human colon, endometrial, and ovarian cancers, correlating with progression, invasiveness, and survival [12-15].
Reference
[1] Itoh, N. and D.M. Ornitz (2008) Dev. Dyn. 237:18.
[2] Miyamoto, M. et al. (1993) Mol. Cell. Biol. 13:4251.
[3] Santos-Ocampo, S. et al. (1996) J. Biol. Chem. 271:1726.
[4] Mohammadi, M. et al. (2005) Cytokine Growth Factor Rev. 16:107.
[5] Plotnikov, A.N. et al. (2001) J. Biol. Chem. 276:4322.
[6] Harada, M. et al. (2009) Nat. Genet. 41:289.
[7] Wu, X.L. et al. (2009) Am. J. Hum. Genet. 85:53.
[8] Colvin, J.S. et al. (1999) Dev. Dyn. 216:72.
[9] Lin, Y. et al. (2009) Dev. Biol. 329:44.
[10] Hung, I.H. et al. (2007) Dev. Biol. 307:300.
[11] Colvin, J.S. et al. (2001) Dev. Dyn 128:2095.
[12] Krejci, P. et al. (2009) Hum. Mutat. 30:1245.
[13] Leushacke, M. et al. (2011) PLoS ONE 6: e23381.
[14] Hendrix, N.D. et al. (2006) Cancer Res. 66:1354.
[15] Abdel-Rahman, W.M. et al. (2008) Hum. Mutat. 29:390.
| Gene ID | 2254 |
| Accession # | P31371 |
| Alternate Names | GAF; Glia-activating factor; HBGF-9 |
| Source | CHO |
| Protein sequence | |
| M.Wt | 27.3 kDa |
| AA Sequence | DYKDDDDKHHHHHHHHLGEVGNYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS |
| Appearance | Solution protein |
| Stability & Storage | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. - 3 years from date of receipt, -20 to -70°C as supplied. |
| Concentration | 1 mg/mL |
| Formulation | Dissolved in sterile PBS buffer. |
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. This solution can be diluted into other aqueous buffers. |
| Biological Activity | Test in progress. |
| Shipping Condition | Shipping with dry ice. |
| Handling | Centrifuge the vial prior to opening. |
| Usage | For Research Use Only! Not to be used in humans. |
Quality Control & DataSheet
- View current batch:
-
Purity > 95%, determined by SDS-PAGE.
- Datasheet
Endotoxin: <1.0 EU per 1 ug of the protein by the LAL method.















