Home >> Signaling Pathways >> Neuroscience >> Amyloid β

Amyloid β

Amyloid β denotes peptides of 36–43 amino acids result from the APP (amyloid precursor protein) and are involved in Alzheimer's disease as the main component of the amyloid plaques.

Compare Products

  1. Cat.No. Product Name Information
  2. B1325 EUK 134 EUK 134, a synthetic superoxide dismutase (SOD)/catalase mimetic, exhibits potent antioxidant activities, and inhibits the formation of β-amyloid and related amyloid fibril.
  3. A8200 DAPT (GSI-IX) DAPT (GSI-IX) is a novel γ-secretase inhibitor, which inhibits Aβ production with IC50 of 20 nM in HEK 293 cells.
  4. A8190 Semagacestat (LY450139) Semagacestat (also known as LY450139), [(2S)-2-hydroxy-N-((2S)-1-((1S)-3-methyl-2-oxo-2,3,4,5-tetrahydro-1H-benzo[d]azepin-1ylamino)-1-oxopropan-2-yl)-3-methylbutanamide] is an azepine class γ-secretase, which is currently being investigated as a potential disease-modifying agent for the treatment of Alzheimer’s disease (AD).
  5. A1102 Amyloid β-peptide (10-35), amide Amyloid β-protein (10-35) was used as a trunCated peptide model for the full-length amyloid β-proteins (1-40) and (1-42) in high-resolution structural studies.
  6. A1053 amyloid A protein fragment [Homo sapiens] Amyloid A proteins (H2N-Ala-Gly-Leu-Pro-Glu-Lys-Tyr-OH), also called Serum amyloid A (SSA) proteins, are a family of apolipoproteins associated with high-density lipoprotein (HDL) in plasma.
  7. A1004 Amyloid Precursor C-Terminal Peptide Amyloid precursor c-terminal peptide (APP) (C86H118N20O27S) has the amino acid sequence Gly-Tyr-Glu-Asn-Pro-Thr-Tyr-Lys-Phe-Phe-Glu-Gln-Met-Gln-Asn.
  8. A1003 Amyloid β-Protein (1-15) Beta-amyloid protein (A beta), a 39-43 amino acid peptide composed of a portion of the transmembrane domain and the extracellular domain of the amyloid precursor protein (APP), is also the principal component of amyloid.
  9. A1002 Beta-Amyloid (1-11) Beta-amyloid (1-11) (Abeta or Aβ) (C56H76N16O22) is a peptide with the sequence H-{Asp}{Ala}{Glu}{Phe}{Arg}{His}{Asp}{Ser}{Gly}{Tyr}{Glu}-OH,which is processed from the Amyloid precursor protein.
  10. A1124 Amyloid Beta-Peptide (1-40) (human) Amyloid β-Peptide (1-40) (human), (C194H295N53O58S1), a peptide with the sequence H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8.
  11. A1123 Amyloid Beta-Peptide (12-28) (human) Amyloid Beta-Peptide (12-28) (human), (C89H135N25O25), a peptide with the sequence H2N-VHHQKLVFFAEDVGSNK-OH, MW= 1955.2.

Items 1 to 10 of 29 total

per page
  1. 1
  2. 2
  3. 3

Set Descending Direction