Other Signal Transduction

Signal Transduction

Cellular responses are triggered by proteins, drugs, or pathogens binding to specific receptors. Receptor mediated signaling is a cascade of enzymatic reactions that amplifies the signal. The agonists and antagonists modulating receptor functionality are essential tools for research and medical practice. read more

Products for Other Signal Transduction

Cat.No. Product Name Information
A1198 Levetiracetam Levetiracetam (LEV) is a newly developed antiepileptic drug (AED) with a broad spectrum of efﬁcacy against partial and generalized seizures.
A2701 Scrambled 10Panx Scrambled 10Panx is the scrambled form of 10Panx (WRQAAFVDSY), a mimetic peptide of pannexin 1 that inhibits dye uptake by macrophages without affecting cellular membrane currents.
A2700 10Panx 10Panx is a mimetic inhibitory peptide of panx1, which is a mammalian protein ectopically expressed to function as a hemi-channel, that readily and reversibly inhibits the panx1 currents.
A1139 GTP binding protein 1 fragment [Multiple species] GTP binding protein 1 fragment [Multiple species], (C46H77N9O12), a peptide with the sequence H2N-Lys-Val-Ile-Thr-Phe-Ile-Asp-Leu-OH, MW= 948.16.
A1135 Growth Hormone (1-43), human Growth Hormone (1-43), human,(C240H358N62O67S1), a peptide with the sequence H2NFPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYS-OH, MW= 5216.2. Growth hormone (GH or HGH), also known as somatotropin or somatropin, is a peptide hormone that stimulates growth, cell reproduction and regeneration in humans and other animals.
A1134 Agouti-related Protein (AGRP) (25-82), human Agouti-related protein also called Agouti-related peptide (AgRP) is a neuropeptide produced in the brain by the AgRP/NPY neuron.
A1133 Epidermal growth factor receptor (994-1002) acetyl/amide Epidermal growth factor receptor (994-1002) acetyl/amide,(C51H76N14O15S), a peptide with the sequence Ac-Asp-Ser-Asn-Phe-Tyr-Arg-Ala-Leu-Met-amide,MW= 1157.3.
A1118 S6 Kinase Substrate Peptide 32 Peptide that measures the activity of kinases that phosphorylate ribosomal protein S6. It can also be used as a substrate.
A1112 Nitric Oxide Synthase (599-613) Blocking Peptide, Bovine Endothelial Cell Nitric oxide synthases (NOSs) are a family of enzymes catalyzing the production of nitric oxide (NO) from L-arginine.
A1111 Endothelin-1 (1-15), amide, human Endothelins are 21-amino acid vasoconstricting peptides produced primarily in the endothelium and have a key role in vascular homeostasis.