Endocrinology and Hormones

Endocrinology and Hormones

The endocrine system is an information signaling system that coordinates most bodily functions. It senses environmental changes and secretes corresponding hormones to coordinate metabolism, maintain homeostasis, and regulate growth and development.read more

Products for Endocrinology and Hormones

Cat.No. Product Name Information
A1659 Dutasteride Dutasteride (Avodart) is an inhibitor of dual 5-alpha-reductase for treating benign prostatic hyperplasia (BPH).
A5065 Bicalutamide Bicalutamide is an active non-steroidal androgen receptor antagonist with IC50 value of 160 nM.[1]
A1428 Fulvestrant (ICI 182,780) Fulvestran is a newer type of estrogen receptor (ER) antagonist with IC50 value of 0.094nM .
A1147 Luteinizing hormone releasing hormone human acetate salt (LHRH)
Luteinizing hormone releasing hormone human acetate salt (LHRH) is a selective acitivator of MMP-2 and MMP-9 [1, 2].
A1135 Growth Hormone (1-43), human Growth Hormone (1-43), human,(C240H358N62O67S1), a peptide with the sequence H2NFPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYS-OH, MW= 5216.2. Growth hormone (GH or HGH), also known as somatotropin or somatropin, is a peptide hormone that stimulates growth, cell reproduction and regeneration in humans and other animals.
A1115 Peptide YY(3-36), PYY, human Peptide YY (PYY) is a short (36-amino acid) peptide released by cells in the ileum and colon in response to feeding.
A1114 Parathyroid Hormone (1-34), bovine Parathyroid hormone (PTH) is the most important endocrine regulator of calcium and phosphorus concentration in extracellular fluid, which is secreted by the chief cell of the parathyroid glands as a polypeptide containing 84 amino acids.
A1084 parathyroid hormone (7-34) [Homo sapiens]/[Macaca fascicularis] parathyroid hormone (7-34) [Homo sapiens] [Macaca fascicularis], (C154H246N48O40S2),a peptide with the sequence H2N-LMHNLGKHLNSMERVEWLRKKLQDVHNF-OH, MW= 3474.03.
A1056 Angiotensin 1/2 + A (2 - 8) Angiotensin 1/2 + A (2 - 8)
A1055 Angiotensin 1/2 (1-8) amide The physiologically active peptide angiotensin-2 (angiotensin 1- 8) is yielded from angiotensin-1, a substrate of ACE (angiotensin converting enzyme), by removing a dipeptide.